Supporting data for the identification of H3C12 [Mass spectrometry] | |||||||||
m/z | z | Peptide score | Peptide sequence | Sequence identifier | MS/MS spectra | ||||
1 | 897.4252 | 4 | 105 | R.85FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK116.R | P68431 | No MS/MS spectra |
Supporting data for the identification of H3C12 [Mass spectrometry] | |||||||||
m/z | z | Peptide score | Peptide sequence | Sequence identifier | MS/MS spectra | ||||
1 | 897.4252 | 4 | 105 | R.85FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK116.R | P68431 | No MS/MS spectra |