 |
 |
 |
 Supporting data for the identification of H3-3B
[Mass spectrometry]
| |||||||||
| m/z | z | Peptide score | Peptide sequence | Sequence identifier | MS/MS spectra | ||||
| 1 | 860.177 | 4 | 65 | R.85FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK116.R | P84243 | No MS/MS spectra |
|||
|
|
|
|
Supporting data for the identification of H3-3B
[Mass spectrometry]
| |||||||||
| m/z | z | Peptide score | Peptide sequence | Sequence identifier | MS/MS spectra | ||||
| 1 | 860.177 | 4 | 65 | R.85FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK116.R | P84243 | No MS/MS spectra |
|||